new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene B4 receptor
LigandBDBM50084106
Substrate/Competitorn/a
Meas. Tech.ChEMBL_98509
IC50 300±n/a nM
Citation Poudrel JMHullot PVidal JPGirard JPRossi JCMuller ABonne C Synthesis and pharmacological profile of new 1,3-disubstituted cyclohexanes as leukotriene B4 receptor antagonists Bioorg Med Chem Lett 6:2349-2354 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene B4 receptor
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50084106
n/a
NameBDBM50084106
Synonyms:CHEMBL77513 | Sodium; [(1S,3S)-1-hydroxy-3-((E)-3-hydroxy-7-phenyl-hept-1-enyl)-cyclohexyl]-acetate
TypeSmall organic molecule
Emp. Form.C21H29O4
Mol. Mass.345.4531
SMILESOC(CCCCc1ccccc1)\C=C\[C@H]1CCC[C@@](O)(CC([O-])=O)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: