Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50248793 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_138744 |
---|
Ki | 0.070000±n/a nM |
---|
Citation | Derrick, I; Moynihan, HA; Broadbear, J; Woods, JH; Lewis, JW 6N-Cinnamoyl-β-naltrexamine and its p-nitro derivative. High efficacy κ-opioid agonists with weak antagonist actions Bioorg Med Chem Lett6:167-172 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50248793 |
---|
n/a |
---|
Name | BDBM50248793 |
Synonyms: | 17-Cyclopropylmethyl-3,14beta-dihydroxy-4,5alpha-epoxy-6beta-(cinnamoylamino)morphinan | CHEMBL473362 |
Type | Small organic molecule |
Emp. Form. | C29H32N2O4 |
Mol. Mass. | 472.5754 |
SMILES | Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)[C@@H](CC[C@@]35O)NC(=O)\C=C\c1ccccc1 |r| |
Structure |
|