| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50248793 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_138744 |
|---|
| Ki | 0.070000±n/a nM |
|---|
| Citation |  Derrick, I; Moynihan, HA; Broadbear, J; Woods, JH; Lewis, JW 6N-Cinnamoyl-β-naltrexamine and its p-nitro derivative. High efficacy κ-opioid agonists with weak antagonist actions Bioorg Med Chem Lett6:167-172 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50248793 |
|---|
| n/a |
|---|
| Name | BDBM50248793 |
|---|
| Synonyms: | 17-Cyclopropylmethyl-3,14beta-dihydroxy-4,5alpha-epoxy-6beta-(cinnamoylamino)morphinan | CHEMBL473362 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H32N2O4 |
|---|
| Mol. Mass. | 472.5754 |
|---|
| SMILES | Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)[C@@H](CC[C@@]35O)NC(=O)\C=C\c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
