new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStromelysin-1
LigandBDBM50288708
Substrate/Competitorn/a
Meas. Tech.ChEBML_102083
Ki 12±n/a nM
Citation Chapman KTWales JSahoo SPNiedzwiecki LMIzquierdo-Martin MChang BCHarrison RKStein RLHagmann WK Inhibition of matrix metalloproteinases by P1 substituted N-carboxyalkyl dipeptides Bioorg Med Chem Lett 6:329-332 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Stromelysin-1
Name:Matrix metalloproteinase (2 and 3)
Synonyms:MMP-3 | Matrix metalloproteinase 3 | Matrix metalloproteinase-3 | Matrix metalloproteinase-3 (MMP-3) | Matrix metalloproteinase-3 (MMP3) | SL-1 | Stromelysin 1 | Transin-1
Type:Enzyme
Mol. Mass.:53973.13
Organism:Homo sapiens (Human)
Description:
Residue:477
Sequence:
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50288708
n/a
NameBDBM50288708
Synonyms:(R)-2-[(S)-1-((S)-3-Methyl-1-phenylcarbamoyl-butylcarbamoyl)-3-phenyl-propylamino]-6-(1-oxo-1,3-dihydro-isoindol-2-yl)-hexanoic acid | CHEMBL112147
TypeSmall organic molecule
Emp. Form.C36H44N4O5
Mol. Mass.612.7584
SMILESCC(C)C[C@H](NC(=O)[C@H](CCc1ccccc1)N[C@H](CCCCN1Cc2ccccc2C1=O)C(O)=O)C(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: