| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50036251 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159618 (CHEMBL760099) |
|---|
| IC50 | 6±n/a nM |
|---|
| Citation |  Freskos, JN; Bertenshaw, DE; Getman, DP; Heintz, RM; Mischke, BV; Blystone, LW; Bryant, ML; Funckes-Shippy, C; Houseman, KA; Kishore, NN; Kocan, GP; Mehta, PP (Hydroxyethyl) sulfonamide HIV-1 Protease inhibitors: Identification of the 2-methylbenzoyl moiety at P-2 Bioorg Med Chem Lett6:445-450 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50036251 |
|---|
| n/a |
|---|
| Name | BDBM50036251 |
|---|
| Synonyms: | CHEMBL141265 | [(1S,2R)-3-(Benzenesulfonyl-isobutyl-amino)-1-benzyl-2-hydroxy-propyl]-carbamic acid benzyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H34N2O5S |
|---|
| Mol. Mass. | 510.645 |
|---|
| SMILES | CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1)S(=O)(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
