Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50289543 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201293 |
---|
IC50 | 27±n/a nM |
---|
Citation | Mantegani, S; Brambilla, E; Cremonesi, P; Caccia, C; Fornaretto, MG; Carfagna, N; Colombo, M; McArthur, RA; Varasi, M (E) and (Z)-3-Styrylpiperidines as sigma ligands Bioorg Med Chem Lett7:1525-1530 (1997) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50289543 |
---|
n/a |
---|
Name | BDBM50289543 |
Synonyms: | 2-{3-[3-((Z)-Styryl)-piperidin-1-yl]-propylsulfanyl}-benzothiazole | CHEMBL38300 |
Type | Small organic molecule |
Emp. Form. | C23H26N2S2 |
Mol. Mass. | 394.596 |
SMILES | C(CSc1nc2ccccc2s1)CN1CCCC(C1)\C=C/c1ccccc1 |
Structure |
|