| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidylprolyl isomerase |
|---|
| Ligand | BDBM50068610 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_66431 |
|---|
| Ki | 8.3±n/a nM |
|---|
| Citation |  Hamilton, GS; Huang, W; Connolly, MA; Ross, DT; Guo, H; Valentine, HL; Suzdak, PD; Steiner, JP FKBP12-binding domain analogues of FK506 are potent, nonimmunosuppressive neurotrophic agents in vitro and promote recovery in a mouse model of parkinson's disease Bioorg Med Chem Lett7:1785-1790 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidylprolyl isomerase |
|---|
| Name: | Peptidylprolyl isomerase |
|---|
| Synonyms: | FK506 binding protein 12 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11960.67 |
|---|
| Organism: | Gallus gallus |
|---|
| Description: | ChEMBL_66431 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFRFKIGRQEVIKGF
EEGVTQMSLGQRAKLTCTPEMAYGATGHPGVIPPNATLLFDVELLRLE
|
|
|
|---|
| BDBM50068610 |
|---|
| n/a |
|---|
| Name | BDBM50068610 |
|---|
| Synonyms: | 1-(3,3-Dimethyl-2-oxo-pentanoyl)-piperidine-2-carboxylic acid 3,3-diphenyl-propyl ester | CHEMBL300040 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H35NO4 |
|---|
| Mol. Mass. | 449.5818 |
|---|
| SMILES | CCC(C)(C)C(=O)C(=O)N1CCCCC1C(=O)OCCC(c1ccccc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
