Reaction Details |
| Report a problem with these data |
Target | Peptidylprolyl isomerase |
---|
Ligand | BDBM50289698 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_66431 |
---|
Ki | 15±n/a nM |
---|
Citation | Hamilton, GS; Huang, W; Connolly, MA; Ross, DT; Guo, H; Valentine, HL; Suzdak, PD; Steiner, JP FKBP12-binding domain analogues of FK506 are potent, nonimmunosuppressive neurotrophic agents in vitro and promote recovery in a mouse model of parkinson's disease Bioorg Med Chem Lett7:1785-1790 (1997) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidylprolyl isomerase |
---|
Name: | Peptidylprolyl isomerase |
Synonyms: | FK506 binding protein 12 |
Type: | PROTEIN |
Mol. Mass.: | 11960.67 |
Organism: | Gallus gallus |
Description: | ChEMBL_66431 |
Residue: | 108 |
Sequence: | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFRFKIGRQEVIKGF
EEGVTQMSLGQRAKLTCTPEMAYGATGHPGVIPPNATLLFDVELLRLE
|
|
|
BDBM50289698 |
---|
n/a |
---|
Name | BDBM50289698 |
Synonyms: | 1-(3,3-Dimethyl-2-oxo-pentanoyl)-piperidine-2-carboxylic acid 1-[2-(4-methoxy-phenyl)-ethyl]-4-phenyl-butyl ester | CHEMBL52001 |
Type | Small organic molecule |
Emp. Form. | C32H43NO5 |
Mol. Mass. | 521.6875 |
SMILES | CCC(C)(C)C(=O)C(=O)N1CCCCC1C(=O)OC(CCCc1ccccc1)CCc1ccc(OC)cc1 |
Structure |
|