BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha/Retinoic acid receptor beta
LigandBDBM50032675
Substrate/Competitorn/a
Meas. Tech.ChEMBL_217648
Ki>550±n/a nM
Citation Wong MFRepa JJClagett-Dame MCurley RW Synthesis and receptor binding affinity of conformationally restricted retinoic acid analogues Bioorg Med Chem Lett 7:2313-2318 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha/Retinoic acid receptor beta
Name:Retinoic acid receptor RXR-alpha/Retinoic acid receptor beta
Synonyms:HBV-activated protein | Nuclear receptor subfamily 1 group B member 2 | RAR-beta | RAR-epsilon | Retinoic acid receptor beta
Type:PROTEIN
Mol. Mass.:50498.70
Organism:Homo sapiens (Human)
Description:ChEMBL_1458015
Residue:455
Sequence:
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032675
n/a
NameBDBM50032675
Synonyms:4-[1-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydronaphthalen-2-yl)vinyl]benzoic acid | BEXAROTENE | CHEMBL1023 | p-(1-(5,6,7,8-Tetrahydro-3,5,5,8,8-pentamethyl-2-naphthyl)vinyl)benzoic acid
TypeSmall organic molecule
Emp. Form.C24H28O2
Mol. Mass.348.4779
SMILESCc1cc2c(cc1C(=C)c1ccc(cc1)C(O)=O)C(C)(C)CCC2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: