| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acidic phospholipase A2 2 |
|---|
| Ligand | BDBM50015214 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_503132 (CHEMBL987630) |
|---|
| IC50 | 2160000±n/a nM |
|---|
| Citation |  Cuélla, MJ; Giner, RM; Recio, MC; Just, MJ; Máñez, S; Ríos, JL Two fungal lanostane derivatives as phospholipase A2 inhibitors. J Nat Prod59:977-9 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acidic phospholipase A2 2 |
|---|
| Name: | Acidic phospholipase A2 2 |
|---|
| Synonyms: | PA2A2_NAJNA | Phospholipase A2, acidic |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13343.23 |
|---|
| Organism: | Naja naja |
|---|
| Description: | ChEMBL_482058 |
|---|
| Residue: | 119 |
|---|
| Sequence: | NLYQFKNMIKCTVPSRSWWDFADYGCYCGRGGSGTPVDDLDRCCQVHDNCYNEAEKISGC
WPYFKTYSYECSQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDNNYNIDLKARCQ
|
|
|
|---|
| BDBM50015214 |
|---|
| n/a |
|---|
| Name | BDBM50015214 |
|---|
| Synonyms: | 6-chloro-2-methoxy-9-acridinyl(4-diethylamino-1-methylbutyl)amine | 6-chloro-N-(5-(diethylamino)pentan-2-yl)-2-methoxyacridin-9-amine | CHEMBL7568 | N'-(6-chloro-2-methoxy-acridin-9-yl)-N,N-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine (Mepacrine) | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine ; (mepacrine) | N-(4-Hydroxy-phenyl)-acetamide | cid_237 | quinacrine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30ClN3O |
|---|
| Mol. Mass. | 399.957 |
|---|
| SMILES | CCN(CC)CCCC(C)Nc1c2ccc(Cl)cc2nc2ccc(OC)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
