Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetXanthine dehydrogenase
LigandBDBM23411
Substrate/Competitorn/a
Meas. Tech.ChEMBL_487004
IC50 12600±n/a nM
Citation Hayashi TSawa KKawasaki MArisawa MShimizu MMorita N Inhibition of Cow's Milk Xanthine Oxidase by Flavonoids J Nat Prod 51:345-348 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Xanthine dehydrogenase
Name:Xanthine dehydrogenase
Synonyms:Xanthine oxidase | Xanthine oxidase (XO)
Type:Protein
Mol. Mass.:146809.00
Organism:Bos taurus (Bovine)
Description:P80457
Residue:1332
Sequence:
MTADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDR
LQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAKNGGCCGGNGNNPNCC
MNQKKDHTVTLSPSLFNPEEFMPLDPTQEPIFPPELLRLKDVPPKQLRFEGERVTWIQAS
TLKELLDLKAQHPEAKLVVGNTEIGIEMKFKNQLFPMIICPAWIPELNAVEHGPEGISFG
AACALSSVEKTLLEAVAKLPTQKTEVFRGVLEQLRWFAGKQVKSVASLGGNIITASPISD
LNPVFMASGTKLTIVSRGTRRTVPMDHTFFPSYRKTLLGPEEILLSIEIPYSREDEFFSA
FKQASRREDDIAKVTCGMRVLFQPGSMQVKELALCYGGMADRTISALKTTQKQLSKFWNE
KLLQDVCAGLAEELSLSPDAPGGMIEFRRTLTLSFFFKFYLTVLKKLGKDSKDKCGKLDP
TYTSATLLFQKDPPANIQLFQEVPNGQSKEDTVGRPLPHLAAAMQASGEAVYCDDIPRYE
NELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSADDIPGSNETGLFNDETVFAKDTV
TCVGHIIGAVVADTPEHAERAAHVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGDLK
KGFSEADNVVSGELYIGGQDHFYLETHCTIAIPKGEEGEMELFVSTQNAMKTQSFVAKML
GVPVNRILVRVKRMGGGFGGKETRSTLVSVAVALAAYKTGHPVRCMLDRNEDMLITGGRH
PFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFHMDNCYKIPNIRGTGRL
CKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKEGDLTHFNQRLE
GFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGAL
IHVYTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAAS
VSTDIYGQAVYEACQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTTGFYRTPNLGY
SFETNSGNAFHYFTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFV
QGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPTEFRVSLLRDCPNKKAIYASKAVG
EPPLFLGASVFFAIKDAIRAARAQHTNNNTKELFRLDSPATPEKIRNACVDKFTTLCVTG
APGNCKPWSLRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23411
n/a
NameBDBM23411
Synonyms:5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | Scutellarein | Scutellarein (2) | Scutellarein (28)
Typeflavone
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)c(O)c(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: