Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP4 receptor
LigandBDBM35847
Substrate/Competitorn/a
Meas. Tech.ChEMBL_570544
IC50 2.1±n/a nM
Citation Cameron KOLefker BAKe HZLi MZawistoski MPTjoa CMWright ASDeNinno SLParalkar VMOwen TAYu LThompson DD Discovery of CP-533536: an EP2 receptor selective prostaglandin E2 (PGE2) agonist that induces local bone formation. Bioorg Med Chem Lett 19:2075-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid EP4 receptor
Name:Prostanoid EP4 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53381.95
Organism:Rattus norvegicus
Description:ChEMBL_1290039
Residue:488
Sequence:
MSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSIICAMSIERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGRSERQYPGTWCFIDWTTNVTA
YAAFSYMYAGFSSFLILATVLCNVLVCGALLRMLRQFMRRTSLGTEQHHAAAAAAVASVA
CRGHAAASPALQRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFINQL
YQPSVVKDISRNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSGRD
GSAQHCSESRRTSSAMSGHSRSFLSRELREISSTSHTLLYLPDLTESSLGGKNLLPGTHG
MGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSQREEPASKGNSLQVTFPSET
LKLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35847
n/a
NameBDBM35847
Synonyms:(15S)-prostaglandin E2 | (5Z,11alpha,13E,15S)-11,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (E,Z)-(1R,2R,3R)-7-(3-Hydroxy-2-((3S)-(3-hydroxy-1-octenyl))-5-oxocyclopentyl)-5-heptenoic acid | CHEMBL548 | DINOPROSTONE | PGE2 | [3H]Dinoprostone | [3H]PGE2 | [3H]Prostaglandin E2 | prostaglandin E2
Typeradiolabeled ligand
Emp. Form.C20H32O5
Mol. Mass.352.4651
SMILESCCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: