| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50294211 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_577088 (CHEMBL1031978) |
|---|
| IC50 | 25000±n/a nM |
|---|
| Citation |  Barrow, EW; Dreier, J; Reinelt, S; Bourne, PC; Barrow, WW In vitro efficacy of new antifolates against trimethoprim-resistant Bacillus anthracis. Antimicrob Agents Chemother51:4447-52 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50294211 |
|---|
| n/a |
|---|
| Name | BDBM50294211 |
|---|
| Synonyms: | 3-(5-((2,4-diaminopyrimidin-5-yl)methyl)-3-hydroxy-2-methoxyphenyl)-1-(1-propylphthalazin-2(1H)-yl)prop-2-en-1-one | BAL-17662 | CHEMBL560502 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H28N6O3 |
|---|
| Mol. Mass. | 472.5389 |
|---|
| SMILES | CCCC1N(N=Cc2ccccc12)C(=O)\C=C\c1cc(Cc2cnc(N)nc2N)cc(O)c1OC |c:5| |
|---|
| Structure | 
|
|---|
Search and Browse
