Reaction Details |
| Report a problem with these data |
Target | Eukaryotic translation initiation factor 4E |
---|
Ligand | BDBM50294223 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_574909 (CHEMBL1023606) |
---|
IC50 | 560±n/a nM |
---|
Citation | Kowalska, J; Lukaszewicz, M; Zuberek, J; Ziemniak, M; Darzynkiewicz, E; Jemielity, J Phosphorothioate analogs of m7GTP are enzymatically stable inhibitors of cap-dependent translation. Bioorg Med Chem Lett19:1921-5 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Eukaryotic translation initiation factor 4E |
---|
Name: | Eukaryotic translation initiation factor 4E |
Synonyms: | EIF4E | IF4E_RABIT |
Type: | PROTEIN |
Mol. Mass.: | 25047.40 |
Organism: | Oryctolagus cuniculus |
Description: | ChEMBL_1511842 |
Residue: | 217 |
Sequence: | MATVEPETTPTPNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
|
|
|
BDBM50294223 |
---|
n/a |
---|
Name | BDBM50294223 |
Synonyms: | 2-amino-9-[(2R,3R,4S,5R)-3,4-dihydroxy-5-{[({[(phosphonatooxy)phosphinato]oxy}(sulfanidyl)phosphoryl)oxy]methyl}oxolan-2-yl]-7-methyl-6-oxido-9H-purin-7-ium | CHEMBL550374 |
Type | Small organic molecule |
Emp. Form. | C11H14N5O13P3S |
Mol. Mass. | 549.243 |
SMILES | C[n+]1cn(C2OC(COP([S-])(=O)OP([O-])(=O)OP([O-])([O-])=O)C(O)C2O)c2nc(N)[n-]c(=O)c12 |
Structure |
|