| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Eukaryotic translation initiation factor 4E |
|---|
| Ligand | BDBM50294223 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_574909 (CHEMBL1023606) |
|---|
| IC50 | 1300±n/a nM |
|---|
| Citation |  Kowalska, J; Lukaszewicz, M; Zuberek, J; Ziemniak, M; Darzynkiewicz, E; Jemielity, J Phosphorothioate analogs of m7GTP are enzymatically stable inhibitors of cap-dependent translation. Bioorg Med Chem Lett19:1921-5 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Eukaryotic translation initiation factor 4E |
|---|
| Name: | Eukaryotic translation initiation factor 4E |
|---|
| Synonyms: | EIF4E | IF4E_RABIT |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25047.40 |
|---|
| Organism: | Oryctolagus cuniculus |
|---|
| Description: | ChEMBL_1511842 |
|---|
| Residue: | 217 |
|---|
| Sequence: | MATVEPETTPTPNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
|
|
|
|---|
| BDBM50294223 |
|---|
| n/a |
|---|
| Name | BDBM50294223 |
|---|
| Synonyms: | 2-amino-9-[(2R,3R,4S,5R)-3,4-dihydroxy-5-{[({[(phosphonatooxy)phosphinato]oxy}(sulfanidyl)phosphoryl)oxy]methyl}oxolan-2-yl]-7-methyl-6-oxido-9H-purin-7-ium | CHEMBL550374 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H14N5O13P3S |
|---|
| Mol. Mass. | 549.243 |
|---|
| SMILES | C[n+]1cn(C2OC(COP([S-])(=O)OP([O-])(=O)OP([O-])([O-])=O)C(O)C2O)c2nc(N)[n-]c(=O)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
