Reaction Details |
| Report a problem with these data |
Target | Thromboxane A2 receptor |
---|
Ligand | BDBM50296851 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_582684 (CHEMBL1051058) |
---|
Ki | >10000±n/a nM |
---|
Citation | Sandham, DA; Adcock, C; Bala, K; Barker, L; Brown, Z; Dubois, G; Budd, D; Cox, B; Fairhurst, RA; Furegati, M; Leblanc, C; Manini, J; Profit, R; Reilly, J; Stringer, R; Schmidt, A; Turner, KL; Watson, SJ; Willis, J; Williams, G; Wilson, C 7-Azaindole-3-acetic acid derivatives: potent and selective CRTh2 receptor antagonists. Bioorg Med Chem Lett19:4794-8 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thromboxane A2 receptor |
---|
Name: | Thromboxane A2 receptor |
Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
Type: | Enyzme |
Mol. Mass.: | 37445.28 |
Organism: | Homo sapiens (Human) |
Description: | P21731 |
Residue: | 343 |
Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
BDBM50296851 |
---|
n/a |
---|
Name | BDBM50296851 |
Synonyms: | 2-(1-(4-chlorophenylsulfonyl)-2-methyl-1H-pyrrolo[2,3-b]pyridin-3-yl)acetic acid | CHEMBL561539 |
Type | Small organic molecule |
Emp. Form. | C16H13ClN2O4S |
Mol. Mass. | 364.803 |
SMILES | Cc1c(CC(O)=O)c2cccnc2n1S(=O)(=O)c1ccc(Cl)cc1 |
Structure |
|