| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha |
|---|
| Ligand | BDBM50298245 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_588425 (CHEMBL1039465) |
|---|
| Ki | 480±n/a nM |
|---|
| Citation |  Henry, O; Lopez-Gallego, F; Agger, SA; Schmidt-Dannert, C; Sen, S; Shintani, D; Cornish, K; Distefano, MD A versatile photoactivatable probe designed to label the diphosphate binding site of farnesyl diphosphate utilizing enzymes. Bioorg Med Chem17:4797-805 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha |
|---|
| Name: | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha |
|---|
| Synonyms: | CAAX farnesyltransferase subunit alpha | FNTA_YEAST | FTase-alpha | Farnesyltransferase | GGTase-I-alpha | Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha | RAM2 | Ras proteins prenyltransferase subunit alpha | Type I protein geranyl-geranyltransferase subunit alpha |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 37495.69 |
|---|
| Organism: | Saccharomyces cerevisiae |
|---|
| Description: | ChEMBL_588425 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MEEYDYSDVKPLPIETDLQDELCRIMYTEDYKRLMGLARALISLNELSPRALQLTAEIID
VAPAFYTIWNYRFNIVRHMMSESEDTVLYLNKELDWLDEVTLNNPKNYQIWSYRQSLLKL
HPSPSFKRELPILKLMIDDDSKNYHVWSYRKWCCLFFSDFQHELAYASDLIETDIYNNSA
WTHRMFYWVNAKDVISKVELADELQFIMDKIQLVPQNISPWTYLRGFQELFHDRLQWDSK
VVDFATTFIGDVLSLPIGSPEDLPEIESSYALEFLAYHWGADPCTRDNAVKAYSLLAIKY
DPIRKNLWHHKINNLN
|
|
|
|---|
| BDBM50298245 |
|---|
| n/a |
|---|
| Name | BDBM50298245 |
|---|
| Synonyms: | 4-Benzoylbenzylphosphonic((2E,6E)-3,7,11-trimethyl dodeca-2,6,10-trienyl phosphoric)anhydride | CHEMBL575827 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H38O7P2 |
|---|
| Mol. Mass. | 560.5553 |
|---|
| SMILES | [#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#8]P([#8])(=O)[#8]P([#8])(=O)[#6]-c1ccc(cc1)-[#6](=O)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
