| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM26521 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_588095 (CHEMBL1044821) |
|---|
| IC50 | 18±n/a nM |
|---|
| Citation |  Paulsen, JL; Liu, J; Bolstad, DB; Smith, AE; Priestley, ND; Wright, DL; Anderson, AC In vitro biological activity and structural analysis of 2,4-diamino-5-(2'-arylpropargyl)pyrimidine inhibitors of Candida albicans. Bioorg Med Chem17:4866-72 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DFR1 | DYR_CANAX | Dihydrofolate Reductase (DHFR) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 22141.77 |
|---|
| Organism: | Candida albicans |
|---|
| Description: | C. albicans DHFR was expressed in E. coli BL21, and purified to homogeneity. |
|---|
| Residue: | 192 |
|---|
| Sequence: | MSKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWE
SIPQKFRPLPDRLNIILSRSYENKIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNE
LINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQPKSELQKFVGDTVLEDDIKEG
DFTYNYTLWTRK
|
|
|
|---|
| BDBM26521 |
|---|
| n/a |
|---|
| Name | BDBM26521 |
|---|
| Synonyms: | 6-ethyl-5-[3-(3,4,5-trimethoxyphenyl)prop-1-yn-1-yl]pyrimidine-2,4-diamine | Propargyl inhibitor, 20 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N4O3 |
|---|
| Mol. Mass. | 342.3923 |
|---|
| SMILES | CCc1nc(N)nc(N)c1C#CCc1cc(OC)c(OC)c(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
