Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase JAK3
LigandBDBM50300196
Substrate/Competitorn/a
Meas. Tech.ChEMBL_592721
Ki 5.5±n/a nM
Citation Wang TDuffy JPWang JHalas SSalituro FGPierce ACZuccola HJBlack JRHogan JKJepson SShlyakter DMahajan SGu YHoock TWood MFurey BFFrantz JDDauffenbach LMGermann UAFan BNamchuk MBennani YLLedeboer MW Janus kinase 2 inhibitors. Synthesis and characterization of a novel polycyclic azaindole. J Med Chem 52:7938-41 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase JAK3
Name:JAK3/JAK1
Synonyms:JAK-3 | JAK3 | Janus kinase 3 | Janus kinase 3 (JAK3) | Janus kinase 3 JAK3 | L-JAK | Leukocyte janus kinase
Type:Protein
Mol. Mass.:125111.08
Organism:Homo sapiens (Human)
Description:P52333
Residue:1124
Sequence:
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ
EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS
GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL
ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP
SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300196
n/a
NameBDBM50300196
Synonyms:10-(4-hydroxyphenyl)-8,13,15-triazatetracyclo[9.6.1.0^{2,7}.0^{14,18}]octadeca-1(18),2(7),3,5,11,14,16-heptaen-9-one | CHEMBL584052 | atropisomer 1 | atropisomer 2
TypeSmall organic molecule
Emp. Form.C21H15N3O2
Mol. Mass.341.3627
SMILESOc1ccc(cc1)C1c2c[nH]c3nccc(-c4ccccc4NC1=O)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: