Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50303551
Substrate/Competitorn/a
Meas. Tech.ChEMBL_596098
EC50 0.07±n/a nM
Citation Frost JMDart MJTietje KRGarrison TRGrayson GKDaza AVEl-Kouhen OFYao BBHsieh GCPai MZhu CZChandran PMeyer MD Indol-3-ylcycloalkyl ketones: effects of N1 substituted indole side chain variations on CB(2) cannabinoid receptor activity. J Med Chem 53:295-315 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | rCB2
Type:Enzyme
Mol. Mass.:39366.68
Organism:Rattus norvegicus (Rat)
Description:Q9QZN9
Residue:360
Sequence:
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50303551
n/a
NameBDBM50303551
Synonyms:3-(2-(3-(2,2,3,3-Tetramethylcyclopropanecarbonyl)-1H-indol-1-yl)ethyl)oxazolidin-2-one | CHEMBL584742
TypeSmall organic molecule
Emp. Form.C21H26N2O3
Mol. Mass.354.4427
SMILESCC1(C)C(C(=O)c2cn(CCN3CCOC3=O)c3ccccc23)C1(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: