| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 14 |
|---|
| Ligand | BDBM50304036 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_601358 (CHEMBL1045995) |
|---|
| EC50 | 2590±n/a nM |
|---|
| Citation |  Ko, H; Das, A; Carter, RL; Fricks, IP; Zhou, Y; Ivanov, AA; Melman, A; Joshi, BV; Kovác, P; Hajduch, J; Kirk, KL; Harden, TK; Jacobson, KA Molecular recognition in the P2Y(14) receptor: Probing the structurally permissive terminal sugar moiety of uridine-5'-diphosphoglucose. Bioorg Med Chem17:5298-311 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 14 |
|---|
| Name: | P2Y purinoceptor 14 |
|---|
| Synonyms: | GPR105 | Insulin Receptor-Related Protein (INSRR) | KIAA0001 | P2RY14 | P2Y14_HUMAN | Purinergic receptor P2Y14 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 38991.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502487 |
|---|
| Residue: | 338 |
|---|
| Sequence: | MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
|
|
|
|---|
| BDBM50304036 |
|---|
| n/a |
|---|
| Name | BDBM50304036 |
|---|
| Synonyms: | CHEMBL605512 | Diphosphoric acid 1''-alpha-D-[1''](glucuronic acid-N-(2-amino-ethyl amide))pyranosyl ester 2-(uridin-5'-yl)ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H28N4O17P2 |
|---|
| Mol. Mass. | 622.3683 |
|---|
| SMILES | NCCNC(=O)[C@H]1O[C@H](OP(O)(=O)OP(O)(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)n2ccc(=O)[nH]c2=O)[C@H](O)[C@@H](O)[C@@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
