Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM31122 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_604689 (CHEMBL1069856) |
---|
IC50 | 2000±n/a nM |
---|
Citation | Koeberle, A; Haberl, EM; Rossi, A; Pergola, C; Dehm, F; Northoff, H; Troschuetz, R; Sautebin, L; Werz, O Discovery of benzo[g]indol-3-carboxylates as potent inhibitors of microsomal prostaglandin E(2) synthase-1. Bioorg Med Chem17:7924-32 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM31122 |
---|
n/a |
---|
Name | BDBM31122 |
Synonyms: | 5-hydroxy-1H-benzo[g]indole-3-carboxylate, 11a |
Type | Small organic molecule |
Emp. Form. | C22H18ClNO3 |
Mol. Mass. | 379.836 |
SMILES | CCOC(=O)c1c(Cc2cccc(Cl)c2)[nH]c2c1cc(O)c1ccccc21 |
Structure |
|