| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM50305664 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_604567 (CHEMBL1065476) |
|---|
| IC50 | 10000±n/a nM |
|---|
| Citation |  Potter, AJ; Ray, S; Gueritz, L; Nunns, CL; Bryant, CJ; Scrace, SF; Matassova, N; Baker, L; Dokurno, P; Robinson, DA; Surgenor, AE; Davis, B; Murray, JB; Richardson, CM; Moore, JD Structure-guided design of alpha-amino acid-derived Pin1 inhibitors. Bioorg Med Chem Lett20:586-90 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM50305664 |
|---|
| n/a |
|---|
| Name | BDBM50305664 |
|---|
| Synonyms: | 5-cyano-1H-benzo[d]imidazole-2-carboxylic acid | CHEMBL595948 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H5N3O2 |
|---|
| Mol. Mass. | 187.1549 |
|---|
| SMILES | OC(=O)c1nc2ccc(cc2[nH]1)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
