| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Purine nucleoside phosphorylase |
|---|
| Ligand | BDBM50214705 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_613432 (CHEMBL1069543) |
|---|
| IC50 | 20.2±n/a nM |
|---|
| Citation |  Hikishima, S; Hashimoto, M; Magnowska, L; Bzowska, A; Yokomatsu, T Structural-based design and synthesis of novel 9-deazaguanine derivatives having a phosphate mimic as multi-substrate analogue inhibitors for mammalian PNPs. Bioorg Med Chem18:2275-84 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Purine nucleoside phosphorylase |
|---|
| Name: | Purine nucleoside phosphorylase |
|---|
| Synonyms: | Inosine phosphorylase | Inosine-guanosine phosphorylase | NP | PNP | PNPH_HUMAN | Purine nucleoside phosphorylase (PNPase) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 32119.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 289 |
|---|
| Sequence: | MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
|
|
|
|---|
| BDBM50214705 |
|---|
| n/a |
|---|
| Name | BDBM50214705 |
|---|
| Synonyms: | 5-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-1,1-difluoropentylphosphonate | 9-(5',5'-difluoro-5'-phosphonopentyl)guanine | 9-(5,5-DIFLUORO-5-PHOSPHONOPENTYL)GUANINE | CHEMBL236708 | [5-(2-Amino-6-oxo-1,6-dihydro-purin-9-yl)-1,1-difluoro-pentyl]-phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H14F2N5O4P |
|---|
| Mol. Mass. | 337.2198 |
|---|
| SMILES | Nc1nc2n(CCCCC(F)(F)P(O)(O)=O)cnc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
