Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A3 |
---|
Ligand | BDBM35804 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_609499 (CHEMBL1071771) |
---|
EC50 | 613±n/a nM |
---|
Citation | Beattie, D; Brearley, A; Brown, Z; Charlton, SJ; Cox, B; Fairhurst, RA; Fozard, JR; Gedeck, P; Kirkham, P; Meja, K; Nanson, L; Neef, J; Oakman, H; Spooner, G; Taylor, RJ; Turner, RJ; West, R; Woodward, H Synthesis and evaluation of two series of 4'-aza-carbocyclic nucleosides as adenosine A2A receptor agonists. Bioorg Med Chem Lett20:1219-24 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A3 |
---|
Name: | Adenosine receptor A3 |
Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36197.32 |
Organism: | Homo sapiens (Human) |
Description: | P0DMS8 |
Residue: | 318 |
Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
BDBM35804 |
---|
n/a |
---|
Name | BDBM35804 |
Synonyms: | (CGS21680) 3-(4-{2-[6-Amino-9-(5-ethylcarbamoylmethyl-3,4-dihydroxy-tetrahydro-furan-2-yl)-9H-purin-2-ylamino]-ethyl}-phenyl)-propionic acid | 2-[4-(2-carboxyethyl)-phenethylamino]-5''''-N-ethylcarboxamidoadenosine | 2-[4-(2-carboxyethyl)phenethylamino]-5''''-N-ethylcarboxamidoadenosine | 2-p-(2-carboxyethyl)phenethylamino-5''''-N-ethylcarboxamidoadenosine | 3-(4-(2-(6-amino-9-((2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-tetrahydrofuran-2-yl)-9H-purin-2-ylamino)ethyl)phenyl)propanoic acid | 3-(4-(2-(6-amino-9-((2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxytetrahydrofuran-2-yl)-9H-purin-2-ylamino)ethyl)phenyl)propanoic acid | 3-(4-{2-[6-Amino-9-((2R,3R,4S,5S)-5-ethylcarbamoyl-3,4-dihydroxy-tetrahydro-furan-2-yl)-9H-purin-2-ylamino]-ethyl}-phenyl)-propionic acid | CGS 21680 | CGS-21680 | CHEMBL331372 | [3H]-CGS 21680 |
Type | radiolabeled ligand |
Emp. Form. | C23H29N7O6 |
Mol. Mass. | 499.5197 |
SMILES | CCNC(=O)[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)nc(NCCc3ccc(CCC(O)=O)cc3)nc12 |
Structure |
|