Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntestinal alkaline phosphatase
LigandBDBM18073
Substrate/Competitorn/a
Meas. Tech.ChEMBL_610124
IC50>5000±n/a nM
Citation Lanier MSergienko ESimão AMSu YChung TMillán JLCashman JR Design and synthesis of selective inhibitors of placental alkaline phosphatase. Bioorg Med Chem 18:573-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Intestinal alkaline phosphatase
Name:Intestinal alkaline phosphatase
Synonyms:Alkaline phosphatase, intestinal
Type:PROTEIN
Mol. Mass.:56804.94
Organism:Homo sapiens (Human)
Description:ChEMBL_1278525
Residue:528
Sequence:
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18073
n/a
NameBDBM18073
Synonyms:(2S)-2-amino-3-phenylpropanoic acid | CHEMBL301523 | L-[2,3,4,5,6-3H]phenylalanine | L-phenylalanine | Phenylalanine
TypeAmino Acid
Emp. Form.C9H11NO2
Mol. Mass.165.1891
SMILESN[C@@H](Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: