Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-dependent protein kinase (PKA)
LigandBDBM50168588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_619399
Ki 960±n/a nM
Citation Bandarage UHare BParsons JPham LMarhefka CBemis GTang QMoody CSRodems SShah SAdams CBravo JCharonnet ESavic VCome JHGreen J 4-(Benzimidazol-2-yl)-1,2,5-oxadiazol-3-ylamine derivatives: potent and selective p70S6 kinase inhibitors. Bioorg Med Chem Lett 19:5191-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-dependent protein kinase (PKA)
Name:cAMP-dependent protein kinase (PKA)
Synonyms:PKA C-alpha | cAMP-dependent protein kinase catalytic (PKA) | cAMP-dependent protein kinase catalytic subunit alpha | cAMP-dependent protein kinase catalytic subunit alpha (PKA) | cAMP-dependent protein kinase catalytic subunit alpha (PKACA) | cAMP-dependent protein kinase catalytic subunit alpha (PKAc) | cAMP-dependent protein kinase catalytic subunit alpha isoform 1 | cAMP-dependent protein kinase, alpha-catalytic subunit
Type:Enzyme Catalytic Subunit
Mol. Mass.:40598.73
Organism:Homo sapiens (Human)
Description:n/a
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50168588
n/a
NameBDBM50168588
Synonyms:4-(1-Ethyl-1H-benzoimidazol-2-yl)-furazan-3-ylamine | 4-(1-ethyl-1H-benzo[d]imidazol-2-yl)-1,2,5-oxadiazol-3-amine | CHEMBL365286
TypeSmall organic molecule
Emp. Form.C11H11N5O
Mol. Mass.229.2379
SMILESCCn1c(nc2ccccc12)-c1nonc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: