| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribonuclease pancreatic |
|---|
| Ligand | BDBM50292722 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_620094 (CHEMBL1109349) |
|---|
| pH | 6±n/a |
|---|
| Ki | 78500±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Dossi, K; Tsirkone, VG; Hayes, JM; Matousek, J; Poucková, P; Soucek, J; Zadinova, M; Zographos, SE; Leonidas, DD Mapping the ribonucleolytic active site of bovine seminal ribonuclease. The binding of pyrimidinyl phosphonucleotide inhibitors. Eur J Med Chem44:4496-508 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribonuclease pancreatic |
|---|
| Name: | Ribonuclease pancreatic |
|---|
| Synonyms: | CAM-RNase A | RNAS1_BOVIN | RNASE1 | RNAse A | RNS1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 16468.79 |
|---|
| Organism: | Bison bison (American bison) |
|---|
| Description: | carboxamidomethylated RNase A |
|---|
| Residue: | 150 |
|---|
| Sequence: | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
|
|---|
| BDBM50292722 |
|---|
| n/a |
|---|
| Name | BDBM50292722 |
|---|
| Synonyms: | 3'-UMP | 3'-uridylic acid | CHEMBL460741 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H13N2O9P |
|---|
| Mol. Mass. | 324.1813 |
|---|
| SMILES | OC[C@H]1O[C@H]([C@H](O)[C@@H]1OP(O)(O)=O)n1ccc(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
