| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Myeloblastin |
|---|
| Ligand | BDBM50310690 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_621098 (CHEMBL1113182) |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  Guay, D; Beaulieu, C; Truchon, JF; Jagadeeswar Reddy, T; Zamboni, R; Bayly, CI; Methot, N; Rubin, J; Ethier, D; David Percival, M Design and synthesis of dipeptidyl nitriles as potent, selective, and reversible inhibitors of cathepsin C. Bioorg Med Chem Lett19:5392-6 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Myeloblastin |
|---|
| Name: | Myeloblastin |
|---|
| Synonyms: | Leukocyte proteinase 3 | MBN | PRTN3 | PRTN3_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27816.30 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1463425 |
|---|
| Residue: | 256 |
|---|
| Sequence: | MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTL
IHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVL
LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTF
FCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYV
DWIRSTLRRVEAKGRP
|
|
|
|---|
| BDBM50310690 |
|---|
| n/a |
|---|
| Name | BDBM50310690 |
|---|
| Synonyms: | CHEMBL1078411 | Cis-(S)-2-amino-N-((1R,2R)-1-cyano-2-phenylcyclopropyl)-3-(thiophen-2-yl)propanamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17N3OS |
|---|
| Mol. Mass. | 311.401 |
|---|
| SMILES | N[C@@H](Cc1cccs1)C(=O)N[C@@]1(C[C@@H]1c1ccccc1)C#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
