| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Growth hormone secretagogue receptor type 1 |
|---|
| Ligand | BDBM50312779 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_615667 (CHEMBL1106012) |
|---|
| IC50 | 2.1±n/a nM |
|---|
| Citation |  Yu, M; Lizarzaburu, M; Beckmann, H; Connors, R; Dai, K; Haller, K; Li, C; Liang, L; Lindstrom, M; Ma, J; Motani, A; Wanska, M; Zhang, A; Li, L; Medina, JC Identification of piperazine-bisamide GHSR antagonists for the treatment of obesity. Bioorg Med Chem Lett20:1758-62 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Growth hormone secretagogue receptor type 1 |
|---|
| Name: | Growth hormone secretagogue receptor type 1 |
|---|
| Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 41334.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
|---|
| Residue: | 366 |
|---|
| Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
|---|
| BDBM50312779 |
|---|
| n/a |
|---|
| Name | BDBM50312779 |
|---|
| Synonyms: | (S)-(4-(1H-indole-6-carbonyl)-3-methylpiperazin-1-yl)(2'-chlorobiphenyl-4-yl)methanone | CHEMBL1080556 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H24ClN3O2 |
|---|
| Mol. Mass. | 457.951 |
|---|
| SMILES | C[C@H]1CN(CCN1C(=O)c1ccc2cc[nH]c2c1)C(=O)c1ccc(cc1)-c1ccccc1Cl |r| |
|---|
| Structure | 
|
|---|
Search and Browse
