Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50312917 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_615898 (CHEMBL1102912) |
---|
IC50 | 0.200000±n/a nM |
---|
Citation | Grimstrup, M; Receveur, JM; Rist, Ø; Frimurer, TM; Nielsen, PA; Mathiesen, JM; Högberg, T Exploration of SAR features by modifications of thiazoleacetic acids as CRTH2 antagonists. Bioorg Med Chem Lett20:1638-41 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50312917 |
---|
n/a |
---|
Name | BDBM50312917 |
Synonyms: | 2-(2-(bis(4-fluorophenyl)methyl)-4-(3-fluorophenyl)thiazol-5-yloxy)acetic acid | CHEMBL1086856 |
Type | Small organic molecule |
Emp. Form. | C24H16F3NO3S |
Mol. Mass. | 455.449 |
SMILES | OC(=O)COc1sc(nc1-c1cccc(F)c1)C(c1ccc(F)cc1)c1ccc(F)cc1 |
Structure |
|