Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 1 |
---|
Ligand | BDBM50313363 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_617125 (CHEMBL1101383) |
---|
EC50 | 19±n/a nM |
---|
Citation | Crosignani, S; Bombrun, A; Covini, D; Maio, M; Marin, D; Quattropani, A; Swinnen, D; Simpson, D; Sauer, W; Françon, B; Martin, T; Cambet, Y; Nichols, A; Martinou, I; Burgat-Charvillon, F; Rivron, D; Donini, C; Schott, O; Eligert, V; Novo-Perez, L; Vitte, PA; Arrighi, JF Discovery of a novel series of potent S1P1 agonists. Bioorg Med Chem Lett20:1516-9 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 1 |
---|
Name: | Sphingosine 1-phosphate receptor 1 |
Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
Type: | Enzyme |
Mol. Mass.: | 42836.02 |
Organism: | Homo sapiens (Human) |
Description: | P21453 |
Residue: | 382 |
Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
BDBM50313363 |
---|
n/a |
---|
Name | BDBM50313363 |
Synonyms: | 3-(4-(6-(cyclohexyl(cyclopropylmethyl)amino)pyrimidine-4-carboxamido)benzylamino)propanoic acid | CHEMBL1090423 | US9150519, 1-82 |
Type | Small organic molecule |
Emp. Form. | C25H33N5O3 |
Mol. Mass. | 451.5612 |
SMILES | OC(=O)CCNCc1ccc(NC(=O)c2cc(ncn2)N(CC2CC2)C2CCCCC2)cc1 |
Structure |
|