| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Eukaryotic translation initiation factor 4E |
|---|
| Ligand | BDBM50316302 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_627826 (CHEMBL1117203) |
|---|
| Kd | 10±n/a nM |
|---|
| Citation |  Jia, Y; Chiu, TL; Amin, EA; Polunovsky, V; Bitterman, PB; Wagner, CR Design, synthesis and evaluation of analogs of initiation factor 4E (eIF4E) cap-binding antagonist Bn7-GMP. Eur J Med Chem45:1304-13 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Eukaryotic translation initiation factor 4E |
|---|
| Name: | Eukaryotic translation initiation factor 4E |
|---|
| Synonyms: | Eif4e | IF4E_MOUSE |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25051.39 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_627826 |
|---|
| Residue: | 217 |
|---|
| Sequence: | MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
|
|
|
|---|
| BDBM50316302 |
|---|
| n/a |
|---|
| Name | BDBM50316302 |
|---|
| Synonyms: | ((2R,3S,4R,5R)-5-(2-amino-7-methyl-6-oxo-1H-purin-1-ium-9(6H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl hydrogen triphosphate | CHEMBL1094973 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H18N5O14P3 |
|---|
| Mol. Mass. | 537.207 |
|---|
| SMILES | C[n+]1cn([C@@H]2O[C@H](COP([O-])(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]2O)c2nc(N)[nH]c(=O)c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
