| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Ligand | BDBM50008352 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_630842 (CHEMBL1109212) |
|---|
| IC50 | 50±n/a nM |
|---|
| Citation |  Nolan, KA; Humphries, MP; Bryce, RA; Stratford, IJ Imidazoacridin-6-ones as novel inhibitors of the quinone oxidoreductase NQO2. Bioorg Med Chem Lett20:2832-6 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Name: | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Synonyms: | Metallothionein-3 | NMOR2 | NQO2 | NQO2_HUMAN | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25917.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P16083 |
|---|
| Residue: | 231 |
|---|
| Sequence: | MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
|
|
|
|---|
| BDBM50008352 |
|---|
| n/a |
|---|
| Name | BDBM50008352 |
|---|
| Synonyms: | 5-(2-(dimethylamino)ethylamino)-8-hydroxy-1-methyl-6H-imidazo[4,5,1-de]acridin-6-one | 5-(2-Dimethylamino-ethylamino)-8-hydroxy-1-methyl-2,10b-diaza-aceanthrylen-6-one(2.0MHCl.2.0MH2O) | CHEMBL124373 | NSC-637991 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20N4O2 |
|---|
| Mol. Mass. | 336.3877 |
|---|
| SMILES | CN(C)CCNc1ccc2nc(C)n3c2c1c(=O)c1cc(O)ccc31 |
|---|
| Structure | 
|
|---|
Search and Browse
