| Reaction Details |
|---|
 | Report a problem with these data |
| Target | D(3) dopamine receptor |
|---|
| Ligand | BDBM50317865 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_630145 (CHEMBL1113736) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Ishikawa, M; Shinei, R; Yokoyama, F; Yamauchi, M; Oyama, M; Okuma, K; Nagayama, T; Kato, K; Kakui, N; Sato, Y Role of hydrophobic substituents on the terminal nitrogen of histamine in receptor binding and agonist activity: development of an orally active histamine type 3 receptor agonist and evaluation of its antistress activity in mice. J Med Chem53:3840-4 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| D(3) dopamine receptor |
|---|
| Name: | D(3) dopamine receptor |
|---|
| Synonyms: | DOPAMINE D3 | DRD3 | DRD3_HUMAN | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 44243.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 400 |
|---|
| Sequence: | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
|
|
|
|---|
| BDBM50317865 |
|---|
| n/a |
|---|
| Name | BDBM50317865 |
|---|
| Synonyms: | 2-(2-(4-tert-Butylphenylthio)ethyl)-1H-imidazole | 4-(2-(4-tert-butylphenylthio)ethyl)-1H-imidazole | CHEMBL1098230 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H20N2S |
|---|
| Mol. Mass. | 260.398 |
|---|
| SMILES | CC(C)(C)c1ccc(SCCc2cnc[nH]2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
