Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase
LigandBDBM50322768
Substrate/Competitorn/a
Meas. Tech.ChEMBL_642383
IC50 85±n/a nM
Citation Fernández-Bachiller MIPérez CGonzález-Muñoz GCConde SLópez MGVillarroya MGarcía AGRodríguez-Franco MI Novel tacrine-8-hydroxyquinoline hybrids as multifunctional agents for the treatment of Alzheimer's disease, with neuroprotective, cholinergic, antioxidant, and copper-complexing properties. J Med Chem 53:4927-37 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholinesterase
Name:Acetylcholinesterase
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase precursor
Type:Enzyme
Mol. Mass.:67659.62
Organism:Bos taurus (bovine)
Description:n/a
Residue:613
Sequence:
MRPPWCPLHTPSLTPPLLLLLFLIGGGAEAEGPEDPELLVMVRGGRLRGLRLMAPRGPVS
AFLGIPFAEPPVGPRRFLPPEPKRPWPGVLNATAFQSVCYQYVDTLYPGFEGTEMWNPNR
ELSEDCLYLNVWTPYPRPSSPTPVLVWIYGGGFYSGASSLDVYDGRFLTQAEGTVLVSMN
YRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVG
MHLLSPPSRGLFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGGAGGNDTELV
ACLRARPAQDLVDHEWRVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGV
VKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLHPED
PARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLSWPLWMGVPHGYE
IEFIFGLPLEPSLNYTIEERTFAQRLMRYWANFARTGDPNDPRDPKAPQWPPYTAGAQQY
VSLNLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQ
FDHYSKQDRCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50322768
n/a
NameBDBM50322768
Synonyms:5-Chloro-7-{[9-(1,2,3,4-tetrahydroacridin-9-ylamino)nonylamino]methyl}quinolin-8-ol Dihydrochloride | CHEMBL1172762
TypeSmall organic molecule
Emp. Form.C32H39ClN4O
Mol. Mass.531.131
SMILESOc1c(CNCCCCCCCCCNc2c3CCCCc3nc3ccccc23)cc(Cl)c2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: