Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHLA class II histocompatibility antigen DRB1-1
LigandBDBM50326703
Substrate/Competitorn/a
Meas. Tech.ChEMBL_661478
IC50 28±n/a nM
Citation Venkatraman PNguyen TTSainlos MBilsel OChitta SImperiali BStern LJ Fluorogenic probes for monitoring peptide binding to class II MHC proteins in living cells. Nat Chem Biol 3:222-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HLA class II histocompatibility antigen DRB1-1
Name:Human leukocyte antigen DR beta chain
Synonyms:DR-1 | DR1 | HLA class II histocompatibility antigen, DRB1-1 beta chain | MHC class I antigen DRB1*1
Type:PROTEIN
Mol. Mass.:29917.79
Organism:Homo sapiens (Human)
Description:ChEMBL_192854
Residue:266
Sequence:
MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCI
YNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326703
n/a
NameBDBM50326703
Synonyms:(5S,8S,11S,14S,17S,20S,23S,26S,29S)-5-acetamido-1-(2-carboxy-4-(dimethylamino)phenyl)-8-(3-guanidinopropyl)-11-(hydroxymethyl)-17,20,23,26,31-pentamethyl-14-(2-(methylthio)ethyl)-2,6,9,12,15,18,21,24,27-nonaoxo-3,7,10,13,16,19,22,25,28-nonaazadotriacontane-29-carboxylic acid | CHEMBL1253327
TypeSmall organic molecule
Emp. Form.C48H78N14O15S
Mol. Mass.1123.283
SMILES[#6]-[#16]-[#6]-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#8])-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#7]-[#6](=O)-[#6@H](-[#6]-[#7]-[#6](=O)-[#6]-c1ccc(cc1-[#6](-[#8])=O)-[#7](-[#6])-[#6])-[#7]-[#6](-[#6])=O)-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6](-[#6])-[#6])-[#6](-[#8])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: