Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; serotonin & dopamine
LigandBDBM50327860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664948
Ki 2020±n/a nM
Citation Xu RHong JMorse CLPike VW Synthesis, structure-affinity relationships, and radiolabeling of selective high-affinity 5-HT4 receptor ligands as prospective imaging probes for positron emission tomography. J Med Chem 53:7035-47 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; serotonin & dopamine
Name:Monoamine transporters; serotonin & dopamine
Synonyms:DA transporter | DAT | DAT1 | Dopamine transporter (DAT) | Dopamine transporter protein (DAT) | SLC6A3 | Sodium-dependent dopamine transporter (DAT) | Solute carrier family 6 member 3
Type:Multi-pass membrane protein
Mol. Mass.:68497.11
Organism:Homo sapiens (Human)
Description:Q01959
Residue:620
Sequence:
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327860
n/a
NameBDBM50327860
Synonyms:(1-Butylpiperidin-4-yl)methyl 7-chloro-8-(methylamino)-2,3-dihydrobenzo[b][1,4]dioxine-5-carboxylate | CHEMBL1258223
TypeSmall organic molecule
Emp. Form.C20H29ClN2O4
Mol. Mass.396.908
SMILESCCCCN1CCC(COC(=O)c2cc(Cl)c(NC)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: