| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase SHV-1 |
|---|
| Ligand | BDBM50021959 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_667618 (CHEMBL1262648) |
|---|
| IC50 | 170±n/a nM |
|---|
| Citation |  Mendonça, N; Manageiro, V; Robin, F; Salgado, MJ; Ferreira, E; Caniça, M; Bonnet, R The Lys234Arg substitution in the enzyme SHV-72 is a determinant for resistance to clavulanic acid inhibition. Antimicrob Agents Chemother52:1806-11 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Beta-lactamase SHV-1 |
|---|
| Name: | Beta-lactamase SHV-1 |
|---|
| Synonyms: | BLA1_KLEPN | Beta-lactamase SHV-1 | SHV-1 beta-lactamase | bla | shv1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 31226.68 |
|---|
| Organism: | Klebsiella pneumoniae (Enterobacteria) |
|---|
| Description: | 4R3B |
|---|
| Residue: | 286 |
|---|
| Sequence: | MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA
AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG
IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
|
|
|
|---|
| BDBM50021959 |
|---|
| n/a |
|---|
| Name | BDBM50021959 |
|---|
| Synonyms: | CHEMBL777 | MM 14151 | US9120808, Clavulanic acid potassium salt | antibiotic MM 14151 | clavulanic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H9NO5 |
|---|
| Mol. Mass. | 199.1608 |
|---|
| SMILES | OC\C=C1/O[C@@H]2CC(=O)N2[C@H]1C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
