Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAntrax lethal toxin
LigandBDBM50329273
Substrate/Competitorn/a
Meas. Tech.ChEMBL_675361
Ki 1.3±n/a nM
Citation Jiao GSKim SMoayeri MCregar-Hernandez LMcKasson LMargosiak SALeppla SHJohnson AT Antidotes to anthrax lethal factor intoxication. Part 1: Discovery of potent lethal factor inhibitors with in vivo efficacy. Bioorg Med Chem Lett 20:6850-3 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Antrax lethal toxin
Name:Antrax lethal toxin
Synonyms:Anthrax lethal factor | lethal factor
Type:PROTEIN
Mol. Mass.:93758.56
Organism:Bacillus anthracis
Description:ChEMBL_1460338
Residue:809
Sequence:
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE
RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD
ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV
YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE
QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR
YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS
DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT
ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP
DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN
QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG
RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE
FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST
DHAERLKVQKNAPKTFQFINDQIKFIINS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329273
n/a
NameBDBM50329273
Synonyms:(R)-2-(4-fluoro-3,5-dimethylphenylamino)-6-(3-(4-fluorophenyl)propylamino)-N-hydroxyhexanamide | CHEMBL1270404
TypeSmall organic molecule
Emp. Form.C23H31F2N3O2
Mol. Mass.419.5079
SMILESCc1cc(N[C@H](CCCCNCCCc2ccc(F)cc2)C(=O)NO)cc(C)c1F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: