Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50329613 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_674962 (CHEMBL1272639) |
---|
Ki | 5160±n/a nM |
---|
Citation | Beierlein, JM; Karri, NG; Anderson, AC Targeted mutations of Bacillus anthracis dihydrofolate reductase condense complex structure-activity relationships. J Med Chem53:7327-36 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate Reductase (DHFR) | baDHFR |
Type: | Enzyme |
Mol. Mass.: | 19120.62 |
Organism: | Bacillus anthracis |
Description: | baDHFR was expressed in E. coli BL21, and purified to homogeneity. |
Residue: | 162 |
Sequence: | MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
|
|
|
BDBM50329613 |
---|
n/a |
---|
Name | BDBM50329613 |
Synonyms: | 5-(3-(2,5-dimethoxybiphenyl-4-yl)but-1-ynyl)-6-methylpyrimidine-2,4-diamine | CHEMBL1270734 |
Type | Small organic molecule |
Emp. Form. | C23H24N4O2 |
Mol. Mass. | 388.4623 |
SMILES | COc1cc(c(OC)cc1C(C)C#Cc1c(C)nc(N)nc1N)-c1ccccc1 |
Structure |
|