Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50175430 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_675735 (CHEMBL1272369) |
---|
IC50 | >1000000±n/a nM |
---|
Citation | Potter, A; Oldfield, V; Nunns, C; Fromont, C; Ray, S; Northfield, CJ; Bryant, CJ; Scrace, SF; Robinson, D; Matossova, N; Baker, L; Dokurno, P; Surgenor, AE; Davis, B; Richardson, CM; Murray, JB; Moore, JD Discovery of cell-active phenyl-imidazole Pin1 inhibitors by structure-guided fragment evolution. Bioorg Med Chem Lett20:6483-8 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50175430 |
---|
n/a |
---|
Name | BDBM50175430 |
Synonyms: | 5-(2-METHOXYPHENYL)-2-FUROIC ACID | 5-(2-methoxyphenyl)furan-2-carboxylic acid | CHEMBL372832 |
Type | Small organic molecule |
Emp. Form. | C12H10O4 |
Mol. Mass. | 218.2054 |
SMILES | COc1ccccc1-c1ccc(o1)C(O)=O |
Structure |
|