| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM50330257 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_676277 (CHEMBL1273518) |
|---|
| Ki | 460±n/a nM |
|---|
| Citation |  Wei, J; Kitada, S; Stebbins, JL; Placzek, W; Zhai, D; Wu, B; Rega, MF; Zhang, Z; Cellitti, J; Yang, L; Dahl, R; Reed, JC; Pellecchia, M Synthesis and biological evaluation of Apogossypolone derivatives as pan-active inhibitors of antiapoptotic B-cell lymphoma/leukemia-2 (Bcl-2) family proteins. J Med Chem53:8000-11 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 20130.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 175 |
|---|
| Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
|---|
| BDBM50330257 |
|---|
| n/a |
|---|
| Name | BDBM50330257 |
|---|
| Synonyms: | 6,6',7,7'-Tetrahydroxy-3,3'-dimethyl-5,5'-bis(2-phenylacetyl)-2,2'-binaphthyl-1,1',4,4'-tetraone | CHEMBL1269072 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H26O10 |
|---|
| Mol. Mass. | 642.607 |
|---|
| SMILES | CC1=C(C(=O)c2cc(O)c(O)c(C(=O)Cc3ccccc3)c2C1=O)C1=C(C)C(=O)c2c(cc(O)c(O)c2C(=O)Cc2ccccc2)C1=O |c:27,t:1| |
|---|
| Structure | 
|
|---|
Search and Browse
