| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM50330251 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_676276 (CHEMBL1273517) |
|---|
| Ki | 140±n/a nM |
|---|
| Citation |  Wei, J; Kitada, S; Stebbins, JL; Placzek, W; Zhai, D; Wu, B; Rega, MF; Zhang, Z; Cellitti, J; Yang, L; Dahl, R; Reed, JC; Pellecchia, M Synthesis and biological evaluation of Apogossypolone derivatives as pan-active inhibitors of antiapoptotic B-cell lymphoma/leukemia-2 (Bcl-2) family proteins. J Med Chem53:8000-11 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM50330251 |
|---|
| n/a |
|---|
| Name | BDBM50330251 |
|---|
| Synonyms: | CHEMBL1269012 | N5,N5'-Bis(4-ethylphenethyl)-6,6',7,7'-tetrahydroxy-3,3'-dimethyl-1,1',4,4'-tetraoxo-1,1',4,4'-tetrahydro-2,2'-binaphthyl-5,5'-dicarboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H40N2O10 |
|---|
| Mol. Mass. | 756.7958 |
|---|
| SMILES | CCc1ccc(CCNC(=O)c2c(O)c(O)cc3C(=O)C(=C(C)C(=O)c23)C2=C(C)C(=O)c3c(cc(O)c(O)c3C(=O)NCCc3ccc(CC)cc3)C2=O)cc1 |c:28,t:20| |
|---|
| Structure | 
|
|---|
Search and Browse
