Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin F2-alpha receptor
LigandBDBM50331737
Substrate/Competitorn/a
Meas. Tech.ChEMBL_686550
Ki 4320±n/a nM
Citation Li LBeaulieu CCarriere MCDenis DGreig GGuay DO'Neill GZamboni RWang Z Potent and highly selective DP1 antagonists with 2,3,4,9-tetrahydro-1H-carbazole as pharmacophore. Bioorg Med Chem Lett 20:7462-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin F2-alpha receptor
Name:Prostaglandin F2-alpha receptor
Synonyms:PGF receptor | PGF2 alpha receptor | PGF2-alpha receptor | PTGFR | Prostaglandin F | Prostanoid FP receptor
Type:Enzyme
Mol. Mass.:40072.29
Organism:Homo sapiens (Human)
Description:P43088
Residue:359
Sequence:
MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL
CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ
ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG
RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD
PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50331737
n/a
NameBDBM50331737
Synonyms:2-((R)-6-fluoro-8-(methylsulfonyl)-9-((S)-1-(4-(trifluoromethyl)phenyl)ethyl)-2,3,4,9-tetrahydro-1H-carbazol-1-yl)acetic acid | CHEMBL1290413
TypeSmall organic molecule
Emp. Form.C24H23F4NO4S
Mol. Mass.497.502
SMILESC[C@@H](c1ccc(cc1)C(F)(F)F)n1c2[C@@H](CC(O)=O)CCCc2c2cc(F)cc(c12)S(C)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: