Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP4 subtype
LigandBDBM50333727
Substrate/Competitorn/a
Meas. Tech.ChEMBL_700671
Ki 0.330000±n/a nM
Citation Li LMathieu MCDenis DTherien AGWang Z The identification of substituted benzothiophene derivatives as PGE(2) subtype 4 receptor antagonists: From acid to non-acid. Bioorg Med Chem Lett 21:734-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP4 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP4 subtype | PGE2 receptor EP4 subtype | PTGER2 | PTGER4 | Prostanoid EP4 receptor
Type:Enzyme
Mol. Mass.:53134.53
Organism:Homo sapiens (Human)
Description:P35408
Residue:488
Sequence:
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50333727
n/a
NameBDBM50333727
Synonyms:3-(4-((N-(1-(2-methoxyphenyl)cyclopropanecarbonyl)sulfamoyl)methyl)phenyl)-N,N,5,7-tetramethylbenzo[b]thiophene-2-carboxamide | CHEMBL1644006
TypeSmall organic molecule
Emp. Form.C31H32N2O5S2
Mol. Mass.576.726
SMILESCOc1ccccc1C1(CC1)C(=O)NS(=O)(=O)Cc1ccc(cc1)-c1c(sc2c(C)cc(C)cc12)C(=O)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: