Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50334456 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_700844 (CHEMBL1646403) |
---|
Ki | 1163±n/a nM |
---|
Citation | Banister, SD; Moussa, IA; Beinat, C; Reynolds, AJ; Schiavini, P; Jorgensen, WT; Kassiou, M Trishomocubane as a scaffold for the development of selective dopamine transporter (DAT) ligands. Bioorg Med Chem Lett21:38-41 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50334456 |
---|
n/a |
---|
Name | BDBM50334456 |
Synonyms: | CHEMBL1643902 | N-(2-(3'-Fluorophenyl)ethyl)-N-methyl-8-aminopentacyclo[5.4.0.02,6.03,10.05,9]undecane |
Type | Small organic molecule |
Emp. Form. | C20H24FN |
Mol. Mass. | 297.4097 |
SMILES | CN(CCc1cccc(F)c1)[C@@H]1C2C3CC4C5CC(C2C35)C14 |r,THB:12:19:17:15.21,11:21:19.20:17,13:20:17:15.21,14:15:19.20:17| |
Structure |
|