| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50336594 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_725618 (CHEMBL1677801) |
|---|
| Ki | 1.3±n/a nM |
|---|
| Citation |  Spetea, M; Windisch, P; Guo, Y; Bileviciute-Ljungar, I; Schütz, J; Asim, MF; Berzetei-Gurske, IP; Riba, P; Kiraly, K; Fürst, S; Al-Khrasani, M; Schmidhammer, H Synthesis and pharmacological activities of 6-glycine substituted 14-phenylpropoxymorphinans, a novel class of opioids with high opioid receptor affinities and antinociceptive potencies. J Med Chem54:980-8 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50336594 |
|---|
| n/a |
|---|
| Name | BDBM50336594 |
|---|
| Synonyms: | CHEMBL1672086 | tert-butyl 2-{[(1S,5R,13R,14S,17S)-10-hydroxy-4-methyl-17-(3-phenylpropoxy)-12-oxa-4-azapentacyclo[9.6.1.0^{1,13}.0^{5,17}.0^{7,18}]octadeca-7(18),8,10-trien-14-yl]amino}acetate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H42N2O5 |
|---|
| Mol. Mass. | 534.6863 |
|---|
| SMILES | CN1CC[C@@]23[C@H]4Oc5c2c(C[C@@H]1[C@@]3(CC[C@@H]4NCC(=O)OC(C)(C)C)OCCCc1ccccc1)ccc5O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
