| Reaction Details |
|---|
 | Report a problem with these data |
| Target | AP-2 complex subunit sigma |
|---|
| Ligand | BDBM50339685 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_735249 (CHEMBL1694511) |
|---|
| Ki | 5960±n/a nM |
|---|
| Citation |  Tu, Z; Li, S; Cui, J; Xu, J; Taylor, M; Ho, D; Luedtke, RR; Mach, RH Synthesis and pharmacological evaluation of fluorine-containing D3 dopamine receptor ligands. J Med Chem54:1555-64 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| AP-2 complex subunit sigma |
|---|
| Name: | AP-2 complex subunit sigma |
|---|
| Synonyms: | AP-2 complex subunit sigma | AP2S1_RAT | Ap17 | Ap2s1 | Claps2 | Sigma-2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17016.49 |
|---|
| Organism: | RAT |
|---|
| Description: | Sigma-2 0 RAT::P62744 |
|---|
| Residue: | 142 |
|---|
| Sequence: | MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
|
|
|
|---|
| BDBM50339685 |
|---|
| n/a |
|---|
| Name | BDBM50339685 |
|---|
| Synonyms: | 4-(Thiophen-3-yl)-N-(4-(4-(2-(2-fluoroethoxy)phenyl)piperazin-1-yl)butyl)benzamide oxalic acid salt | CHEMBL1689006 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H32FN3O2S |
|---|
| Mol. Mass. | 481.625 |
|---|
| SMILES | FCCOc1ccccc1N1CCN(CCCCNC(=O)c2ccc(cc2)-c2ccsc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
