Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50341519 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_742148 (CHEMBL1769208) |
---|
Ki | >1000±n/a nM |
---|
Citation | Charrier, JD; Miller, A; Kay, DP; Brenchley, G; Twin, HC; Collier, PN; Ramaya, S; Keily, SB; Durrant, SJ; Knegtel, RM; Tanner, AJ; Brown, K; Curnock, AP; Jimenez, JM Discovery and structure-activity relationship of 3-aminopyrid-2-ones as potent and selective interleukin-2 inducible T-cell kinase (Itk) inhibitors. J Med Chem54:2341-50 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50341519 |
---|
n/a |
---|
Name | BDBM50341519 |
Synonyms: | (S)-3-(4-(2-(pyrrolidin-1-ylmethyl)pyrrolidin-1-yl)benzoylamino)-5-(6-(methylamino)pyrazin-2-yl)-(1H)-pyridin-2-one | CHEMBL1765781 |
Type | Small organic molecule |
Emp. Form. | C26H31N7O2 |
Mol. Mass. | 473.57 |
SMILES | CNc1cncc(n1)-c1c[nH]c(=O)c(NC(=O)c2ccc(cc2)N2CCC[C@H]2CN2CCCC2)c1 |r| |
Structure |
|